Wholesale Marketplace
Home >

Muscle Growth Hormone

Refine Search

Business Type

Region

muscle growth hormone

All muscle growth hormone wholesalers & muscle growth hormone manufacturers come from members. We doesn't provide muscle growth hormone products or service, please contact them directly and verify their companies info carefully.

Total 20867 products from muscle growth hormone Manufactures & Suppliers
  Manufactures

Brand Name:Jiacheng

Model Number:Human Growth Hormone

Place of Origin:China

Purity Human Growth Hormone Injections 96827-07-5 for Burns Treatment Product Details: Kigtropin HGH 10iu/vial, 10vials/kit, 8iu/vial, 25vials/kit CAS: 96827-07-5 Appearance: White Freeze dried Powder Restful sleep (even for insomniacs) Improved mood and sense of well being Hair color restoration and growth Return of vitality, energy, stamina Improved memory, alertness & concentration Substantial increase in bone density Improved vision, cholesterol & blood pressure Faster recovery from

Zhuhai jiacheng Sci. & Tech. Co., Ltd
Verified Supplier

Guangdong

  Manufactures

Brand Name:SR Health Tech

Model Number:303-42-4

Place of Origin:China

Primobolan Anabolic Steroids Injections , Methenolone Enanthate Muscle Growth Hormone Methenolone Enanthate Primobolan Depot Product Name: Methenolone enanthate CAS: 303-42-4 MF: C27H42O3 MW: 414.62 EINECS: 206-141-6 Usage: pharmaceutical material, Steroid hormone, Anabolin. As a male hormone and anabolic hormones. Standard: Enterprise standard Specifications: TEST ITEMS SPECIFICATION RESULTS Description White Crystalline Powder Melting Point 64℃~72℃ 65℃~69℃ Specific Rotation +50°~ +56°(C=1...

Steroidraws Health Tech Company Limited
Verified Supplier

Hong Kong

  Manufactures

Brand Name:ChineseHormone

Model Number:CAS 23454-33-3

Place of Origin:China

Tren Hexahydrobenzylcarbonate Trenbolone Steroid Muscle Growth Hormone CAS: 23454-33-3 EINECS: 245-669-1 Molecular formula: C26H34O4 Molecular weight: 410.55 Assay: 99% min. Packing: Foil bag or tin or as required. Delivery: Express courier. Character: White to light yellow crystalline powder. Usage: Pharmaceutical material, Steroid hormone, Anabolin. As a male hormone and anabolic hormones. Trenbolone Cyclohexylmethylcarbonate; Parabolan; Anabolic Hormones; Anabolin; Anabolic Steroids; Steroid

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

  Manufactures

Brand Name:BestSteroid

Model Number:2243-6-3

Place of Origin:Hubei,China

Bodybuilding Prohormone Supplements 6-OXO Androst-4-ene-3,6,17-trione For Muscle Growth 6-OXO Basic Info Name: 6-OXO Alias: 4-androstene-3, 6, 17- trione; Androst-4-ene-3, 6, 17-trione; 4-Androstenetrione; 4-Androstenetriol CAS: 2243-06-3 Molecular Weight: 300.39 Molecular Formula: C19H24O3 Melting Point: 223-224° C Package: Foil bag or tin, or as you require Properties: White powder Usage: Steroid drug intermediates. Low Estrogen Levels. 6-OXO Description 6-OXO also known as 4-androsten-3,6,17.

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

  Manufactures

Brand Name:KANGDISEN

Model Number:white powder

Place of Origin:China

Dianabol 72-63-9 Muscle Growth Hormone Metandienone Methandienone Metandienone (INN) (brand names Averbol, Dianabol, Danabol, Metanabol, Naposim, Vetanabol), or methandienone (BAN), also known as methandrostenolone, as well as 17α-methyl-δ1-testosterone or as 17α-methylandrost-1,4-dien-17β-ol-3-one, is an orally active, synthetic anabolic-androgenic steroid (AAS) and a 17α-methylated derivative of testosterone (specifically, the 17α-methylated derivative of boldenone (Δ1-testosterone)) that was

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

  Manufactures

Brand Name:YIHAN

Model Number:Triptorelin

Place of Origin:Guangzhou China

Antineoplastic Triptorelin Human Growth Hormone Peptide Muscle Growth CAS 57773-63-4 GNRH (Triptorelin ) 100mcg/vial Triptorelin, a decapeptide, is a gonadotropin-releasing hormone agonist (GnRH agonist) used as the acetate. By causing constant stimulation of the pituitary, it decreases pituitary secretion of gonadotropins luteinizing hormone (LH) and follicle stimulating hormone (FSH). CAS: 57773-63-4 Molecular Formula: C64H82N18O13 Molecular Weight: 1311.45 Appearance: White Powder Country of

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

  Manufactures

Brand Name:Walk

Place of Origin:China Mainland

Human Growth Hormone Of Peptide Hormone HGH To Stimulate Bone And Muscle Growth Product Descriptions: · Product Name: HGH · Place of Origin: Mainland of China · Type: Growth Hormones · Grade Standard: Pharmaceutical grade · Brand Name: Walk · Purity: 99% Special Advantages: Domestic Delivery We provide domestic delivery from Europe countries, and from USA, Canada, and South America. Anyone who needs this domestic delivery service have to pay more. It is the safest way that only we can give to ..

Walk Bio-Tech Co., Ltd.
Verified Supplier

Guangdong

  Manufactures

Brand Name:Hong Kong Blue Universal

Model Number:10161-34-9

Place of Origin:China

About trenbolone acetate Trenbolone Acetate is a 19-nortestosterone anabolic androgenic steroid.This classification refers to a structural change of the testosterone hormone in that it lacks a carbon atom at the 19th position. This puts Trenbolone Acetate in the same category as Deca Durabolin (Nandrolone Decanoate). In fact, the Trenbolone itself issimply a modified form of the Nandrolone hormone. Trenbolone hormone carries a double bond at carbons 9 and 11, which in turn slows its metabolism,

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

  Manufactures

Brand Name:Biopro

Model Number:BBS-14

Place of Origin:China

Prohormone Supplements Muscle growth hormone / Yohimbine HCL for Burnning Fat CAS 65-19-0 Yohimbine has been a popular supplement for both men and women For years. This is due to its ability to Maximize sex drive, reduce blood pressure, burn fat and Suppress appetite.Yohimbine HCl is primarily used as a treatment for erectile dysfunction.As Yohimbine HCl powder dilates the blood vessels, this also helps to reduce blood pressure. Not only is this good for the heart, but it helps to improve the ..

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

  Manufactures

Brand Name:Granduni or OEM

Model Number:CAS:1424-00-6

Place of Origin:China

CAS NO1424-00-6 Muscle Growth Steroids Tbol Mesterolone Proviron DHT Compound Hormones Product Description Anti-Estrogen High Purity Hormone Powder Proviron(Mesterolon) product details: Mesterolon (Proviron) CAS NO.: 1424-00-6 Purity: 99% Chemical Name: 17beta-Hydroxy-1alpha-methyl-5alpha-androstan-3-one; 1alpha-Methylandrostan-17beta-ol-3-one Molecular Formula: C20H32O2 Molecular weight: 304.47 Standard: Enterprise Standard Packing: 1kg/aluminum foil bag 2. min. order quantity: 10g 3. Payment:

GRAND UNIVERSE INDUSTRIAL LIMITED
Verified Supplier

Guangdong

  Manufactures

Brand Name:Best anabolicsteroid

Model Number:99

Place of Origin:China

19-Nortestosterone Legal Steroids For Muscle Growth Hormone Nandrolone Base Nandrolone (Steroids) Skype nancynancy2614 Synonyms: 19-nortestosterone standard solution; Nandrolone Base CAS: 434-22-0 EINECS: 207-101-0 Molecular Fomular: C18H26O2 Molecular Structure: Assay: 97% min Packing: foil bag or tin. Delivery: Express courier. The min. order is 10 grams. Character: White crystalline powder. Usage: pharmaceutical material, Steroid hormone, Anabolin. An anabolic steroid. Controlled substance ..

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

  Manufactures

Brand Name:Roids

Model Number:434-05-9

Place of Origin:China

Methenolone Acetate Raw Steroid Powder Primobolan Muscle Growth Hormone Methenolone Acetate Quick Details: Product name: Methenolone Acetate Synonyms: Nibal;premobolan;primobolan;primobolone;primonabol CAS : 434-05-9 M.F.: C22H32O3 M.W.: 34.49 Assays: 98% Appearance: White or white crystalline powder Product Categories: Steroids;Steroid and Hormone;methenolone series Methenolone Acetate Introduction: Primobolan is an expensive steroid; this is the main reason it is not as popular as one would ..

Shenzhen Roids Technology Co.,Ltd
Verified Supplier

Guangdong

  Manufactures

Brand Name:Bio Friend(BOF)

Model Number:106505-90-2

Place of Origin:China Wuhan

Boldenone Cypionate Muscle Growth Hormone Raw Steroid Powder 106505-90-2 COA: Product name Boldenone Cypionate Water Content 0.5%max 0.28% Specific Rotation 0.5%max 0.22% Residue on Ignition 0.1%max 0.06% Density 1.020-1.035 1.030 Characteristics off-yellow thickness liquid Pass Solubility Almost insoluble in water, soluble in vegetable oil Conforms Specific optical rotation +28o~+35o +33.4o Identification IR,TLC Positive Heavy Metals 10PPm <10PPm Assay 97.0% 97.13% Related substances 3.0%max <3

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

  Manufactures

Model Number:99%

Place of Origin:China

Anabolic Steroid Powder Stanolone Androstanolone DHT CAS 521-18-6 for Bodybuilding Quick details: Product Name: Stanolone Alias: Androstanolone; Dihydrotestosterone/ Andractim / DHT Chemical Name: 5a-androstan-17ß-ol-3-one CAS: 521-18-6 MF: C19H30O2 MW: 290.44 EINECS: 208-307-3 Purity: 99.3% Pack: Stealth pack Appearance: White Crystalline Powder Description: Androstanolone is chemically identical to DHT. DHT is mainly formed in the testes, the hair follicles, the adrenal glands and the prostate

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

  Manufactures

Brand Name:Jusheng Brand

Model Number:2322-77-2

Place of Origin:China

Effective Methoxydienone Max LMG For Sexual Enhancer and Muscle Mass 2322-77-2 Hormone Quick detail Product Name: Methoxydienone Synonyms: METHOXYDIENONE;13-beta-Ethyl-3-methoxygona-2,5(10)-dien-17-one;(8r,9s,13s,14s)-13-ethyl-3-methoxy-4,6,7,8,9,11,12,14,15,16-decahydro-1h-cyclopenta[a]phenanthren-17-one;13-Ethyl-3-methoxy-gona-2,5(10; CAS: 2322-77-2 MF: C20H28O2 MW: 300.44 Density :1.09g / cm3 Boiling point : 448 ° C at 760 mmHg Flash Point : 188.8 ° C Vapor Pressure : 3.21E-08mmHg at 25 ° C .

Hubei Jusheng Technology Co., Ltd.
Verified Supplier

Hubei

  Manufactures

Brand Name:jinshengyu

Model Number:001

Place of Origin:china

Detailed Product Description Recombinant Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized powder. Manufacturer :Hezhong Usage : Losing Cellulite and Wrinkles,Gaining muscle / losing fat/weight loss,Return of sexual potency, drive and pleasure,Restful sleep (even for insomniacs),Improved mood and sense of well being,Hair color restoration and growth,Return of vitality, energy, stamina

wuhan jin shengyu biological technology co.,ltd
Verified Supplier

Hubei

  Manufactures

Brand Name:YIDA

Model Number:Food Graade

Place of Origin:CHina

BCAA FUNCTION 1. BCAA supports extreme muscle growth 2. BCAA builds strength and tremendous power 3. BCAA timed release to support anti-catabolic effects 4. BCAA support increased strength and mass 5. BCAA and leucine may support improved recovery and reduced soreness 6. BCAA promote increased endurance exercise capacity 7. BCAA supplementation provides support against catabolism BCAA Avaliable BCAA 2:1:1 BCAA 4:1:1 BCAA 8:1:1 BCAA 16:1:1 Instant BCAA BCAA granular BCAA microgranular Fruit ...

Yi Da Chemical CO.LTD
Verified Supplier

Jiangsu

  Manufactures

Brand Name:KANGDISEN

Model Number:10mg x 60 tablets

Place of Origin:China

...Nolvadex Tamoxifen Citrate Muscle Growth Hormone Genox Tamifen 10540-29-1 Tamoxifen: 10mg x 60 tablets/bottle is available. Nolvadex (tamoxifen citrate) is a ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

  Manufactures

Brand Name:jinshengyu

Model Number:001

Place of Origin:china

... Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized powder. Manufacturer :Hezhong Usage : Losing Cellulite and Wrinkles,Gaining muscle...

wuhan jin shengyu biological technology co.,ltd
Verified Supplier

Hubei

  Manufactures

Brand Name:Pharmlab

Model Number:IGF-1 LR3

Place of Origin:China

...Human Growth Hormone Peptide IGF-1 LR3 1mg For Natural Muscle Growth Quick detial Product name: IGF-1Lr3 Appearance:White lyophilized powder Specification: 1mg/vial Packing:10vials per kits Catagory: Human Growth Hormone Peptide There was a variety...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

  Manufactures

Brand Name:Best anabolicsteroid

Model Number:99

Place of Origin:China

...19-Nortestosterone Legal Steroids For Muscle Growth Hormone Nandrolone Base Nandrolone (Steroids) Skype nancynancy2614 Synonyms: 19-nortestosterone standard solution; Nandrolone Base CAS: 434-...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

  Manufactures

Brand Name:Roids

Model Number:10161-34-9

Place of Origin:China

...Trenbolone Acetate Steroid CAS 10161-34-9 , Muscle Growth Hormone For Bulking Cycle Product Name: Trenbolone Acetate Alias:Revalor-H;trienboloneacetate CAS: 10161-34-9 Assay: >99% ...

Shenzhen Roids Technology Co.,Ltd
Verified Supplier

Guangdong

  Manufactures

Brand Name:Biopro

Model Number:GHP-37

Place of Origin:China

...GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 7,372 Da Synonyms: IGF-...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

  Manufactures

Brand Name:SBJ

Model Number:Hgh Fragment 176-191

Place of Origin:China

...Muscle Growth Hormone Peptides Hgh Fragment 176-191 (2mg/vial) For Bodybuilding Supplements Notes: Hgh Fragment 176-191≠ ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

  Manufactures

Brand Name:HongKong Blue

Model Number:Hygetropin

Place of Origin:CHINA

...Legal Muscle Growth Hormone Lyophilized Powder 200IU Hygetropin Peptides >>>>>>>>>>>>About us: Good quality: We insist that quality is our ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

  Manufactures

Brand Name:Shanghai Stero

Model Number:121062-08-6

Place of Origin:China

...Melanotan 2 Lean Muscle Growth Hormone Peptides Muscle Building Melanotan II Description: Melanotan 2 is a synthetically created peptide that stimulates skin tanning, increased libido, ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

  Manufactures

Brand Name:JNJG

Model Number:30729649

Place of Origin:CHINA

...Muscle Growth Hormone Peptides Bodybuilding 1mg / Vial Follistatin 315 Fst -315 Follistatin 315 Quick Detail: Product Name: Follistatin ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

  Manufactures

Brand Name:Bio Friend(BOF)

Model Number:106505-90-2

Place of Origin:China Wuhan

...Boldenone Cypionate Muscle Growth Hormone Raw Steroid Powder 106505-90-2 COA: Product name Boldenone Cypionate Water Content 0.5%max 0.28% Specific ...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

  Manufactures

Brand Name:email: lisa@pharmade.com

Model Number:15262-86-9

Place of Origin:China

...Testosterone Decanoate Muscle Growth Hormone Nutrition Supplements Neotest 250 Description: Testosterone Decanoate: Anabolic Hormones; Anabolin; Anabolic Steroids; Steroid Powder; Hormone Powders; Bodybuilding; Raw Powder; Muscle Building; Raw Testosterone...

Shenzhen Shijingu Technology Co., Ltd.
Verified Supplier

Guangdong

  Manufactures

Brand Name:NJBN STERIOD

Model Number:171596-29-5

Place of Origin:Made-in-China

...Anabolic Sex Muscle Growth Hormones Without Side Effects Tadalafil 171596-29-5 Basic information Name Tadalafil Appearence White crystalline powder Cas ...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

  Manufactures

Brand Name:Pharm-China

Model Number:158861-67-7

Place of Origin:Shanghai,China

...Muscle Building Steroid peptide GHRP-2 5 mg/vial or 10mg/vial Growth Hormone Releasing Peptides For Bodybuilding and fat loss Email:matthew@pharm-china.com 1. Important Info: GHRP-2 ...

Shanghai Yijing Pharmaceutical Co.,Ltd
Verified Supplier

Shanghai

  Manufactures

Brand Name:SR Health Tech

Model Number:315-37-7

Place of Origin:China

...Muscle Growth Hormone Peptides Hgh For Bodybuilding Supplements, HGH with safe delivery, SR Health Tech Name HGH Alias ...

Steroidraws Health Tech Company Limited
Verified Supplier

Hong Kong

  Manufactures

Brand Name:Yuancheng

Model Number:855-19-6

Place of Origin:Wuhan,Hubei

...Raw Muscle Growth Hormone Powder Turinabol Clostebol Acetate CAS855-19-6 Alias: Megagrisevit; Clostebol acetate CAS No: 855-19-6 Einecs ...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

  Manufactures

Brand Name:KA-XING

Model Number:315-37-7

Place of Origin:Guangdong ,China

CJC-1295 without DAC from Peptides 1.Quick Detail: Product Name: CJC-1295 English name: CJC-1295 (without DAC) CAS number: 863288-34-0 Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Tyr- Gln-Asp-Ile-Leu-Ser-Arg-NH2 Molecular formula: C152H252N44O42 ...

Zhuhai Jiacheng Bio-Tech Co., Ltd.
Verified Supplier

Macau

  Manufactures

Brand Name:wumeitech

Model Number:Hexarelin Acetate

Place of Origin:China

...Lyophilized Peptides Powder Hexarelin (Hexarelin Acetate) for Muscle Growth Alias: HEX, Hexarelin Acetate, Examorelin Hexarelin CAS: 140703-51-1 Hexarelin Sequence: His-D-2-methyl-Trp-Ala-...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

  Manufactures

Brand Name:Generic hgh

Model Number:yellow top hgh

Place of Origin:China

...: When HGH is referred to by the color of the vial caps it's usually generic growth hormone made by various labs in China. There are not more than a handful certified labs, capable...

Marvel Pharma Inc.
Active Member

Hunan

  Manufactures

Brand Name:RuiJin

Model Number:Haratropin

Place of Origin:CHina

Blue Tops Taitropin 100iu/kits Natural HGH Supplements For Get taller / Fat Loss Quick Detail: Commodity Name: Haratropin Specification:10iu/vial,10vials/kit Status:Brand new, expiration date in 3 years Delivery time:send products out in 24 hours after ...

Shenzhen RuiJin Pharmaceutical Co.,Ltd
Active Member

Guangdong

Go to Page
Inquiry Cart 0