Wholesale Marketplace
Home >

Muscle Growth Hormone

muscle growth hormone

All muscle growth hormone wholesalers & muscle growth hormone manufacturers come from members. We doesn't provide muscle growth hormone products or service, please contact them directly and verify their companies info carefully.

Total 16843 products from muscle growth hormone Manufactures & Suppliers
Buy cheap Muscle Growth Hormone Peptides Bodybuilding 1mg / Vial Follistatin 315 Fst -315 white powder product

Brand Name:JNJG

Model Number:30729649

Place of Origin:CHINA

...Muscle Growth Hormone Peptides Bodybuilding 1mg / Vial Follistatin 315 Fst -315 Follistatin 315 Quick Detail: Product Name: Follistatin ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap Human Growth Hormone Peptide IGF-1 LR3 1mg , Natural Muscle Growth Hormone Peptide product

Brand Name:Pharmlab

Model Number:IGF-1 LR3

Place of Origin:China

...Human Growth Hormone Peptide IGF-1 LR3 1mg For Natural Muscle Growth Quick detial Product name: IGF-1Lr3 Appearance:White lyophilized powder Specification: 1mg/vial Packing:10vials per kits Catagory: Human Growth Hormone Peptide There was a variety...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap Recombinant HGH Human Growth Hormone IGF LR3 -1 Muscle Growth Hormone product

Brand Name:jinshengyu

Model Number:001

Place of Origin:china

... Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized powder. Manufacturer :Hezhong Usage : Losing Cellulite and Wrinkles,Gaining muscle...

wuhan jin shengyu biological technology co.,ltd
Verified Supplier

Hubei

Buy cheap 99% Bulking Muscle Growth Hormone Peptides Mgf (Igf-1des) 2mg/Vial product

Brand Name:PURITY

Place of Origin:china

...99% bulking Growth Hormone Peptides Mgf(Igf-1ec) 2mg/Vial for Muscle Growth Product Description Quick detail Unit Size :2 mg/vial Unit Quantity :1 Vial Synonyms :MGF (Mechano Growth Factor) Molecular Formula :C121H200N42O39 Molecular Weight :2867...

Zhuzhou Yuancheng Hezhong Technology Development Co., Ltd.
Verified Supplier

Hunan

Buy cheap Muscle Growth Hormone withe raw powder Oral Oxandrolone / Anavar CAS NO.53-39-4 product

Brand Name:DW

Model Number:CAS NO:53-39-4

Place of Origin:China

...Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 USP Standard Oxandrolone / Anavar Quick Info Product Name: Oxandrolone CAS: ...

Doublewin Biological Technology Co., Ltd.
Verified Supplier

Guangxi

Buy cheap Mass Body Building Muscle Growth Hormone Hgh Supplement Hygetropin 8iu / Vial product

Brand Name:dingsheng

Model Number:hygetropin

Place of Origin:China

...Skype:jhonrcbest Pharmaceutical Mass Body Building Growth Hormone Peptides Hgh Hygetropin 8iu / Vial 10iu / Vial product detail Product name: hygetropin Assay: 99.8% Packaging ...

Linyi dingsheng chemical products Co., Ltd
Verified Supplier

Shandong

Buy cheap Melanotan 2 Lean Muscle Growth Hormone Peptides Muscle Building Melanotan II product

Brand Name:Shanghai Stero

Model Number:121062-08-6

Place of Origin:China

...Melanotan 2 Lean Muscle Growth Hormone Peptides Muscle Building Melanotan II Description: Melanotan 2 is a synthetically created peptide that stimulates skin tanning, increased libido, ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Buy cheap Hgh Fragment 176-191 (2mg/vial) Muscle Growth Hormone Peptides Lyophilized Powder For Bodybuilding Supplements product

Brand Name:LSW

Model Number:Hgh Fragment 176-191

Place of Origin:China

...Muscle Growth Hormone Peptides Hgh Fragment 176-191 (2mg/vial) For Bodybuilding Supplements Notes: Hgh Fragment 176-191≠ ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Buy cheap Anabolic Sex Muscle Growth Hormones Without Side Effects Tadalafil 171596-29-5 product

Brand Name:NJBN STERIOD

Model Number:171596-29-5

Place of Origin:Made-in-China

...Anabolic Sex Muscle Growth Hormones Without Side Effects Tadalafil 171596-29-5 Basic information Name Tadalafil Appearence White crystalline powder Cas ...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Buy cheap Safety USP GHRP-2 Muscle Growth Hormone Injectable Lyophilized Powder CAS 158861-67-7 product

Brand Name:Muscle Man

Model Number:ychz04@chembj.com

Place of Origin:China

...Safety USP GHRP-2 Muscle Growth Hormone Injectable Lyophilized Powder CAS 158861-67-7 1. Product details GHRP-2 CAS Number: 158861-67-7 Molecular Formula: ...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap Muscle Growth Hormone Peptides Ipamorelin for Bodybuilding CAS 170851-70-4 product

Brand Name:JNJG

Model Number:170851-70-4

Place of Origin:CHINA

...Muscle Growth Hormone Peptides Ipamorelin for Bodybuilding CAS 170851-70-4 Ipamorelin Details: Product Name Ipamorelin Ipamorelin Alias NNC ...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier

Shandong

Buy cheap Muscle Growth Hormone Gensic HGH hygetropin 200iu jintropin for bodybuilding product

Brand Name:Hong Kong Blue

Model Number:HGH hygeteropin

Place of Origin:China

...Legit Human Growth Hormone Gensic HGH hygetrpin 200iu for bodybuilding Guarantee safe shipping Hygetropin 200iu 25iu/vial, 10vials/kit ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap Oxandrolone Male Muscle Growth Hormones Powder CAS 53-39-4 / Bodybuilding Supplements product

Brand Name:Sendi

Model Number:Oxandrolone

Place of Origin:China

...Oxandrolone Male Muscle Growth Hormones powder CAS 53-39-4 Bodybuilding Supplements Quick details: Oxandrolone (Anavar), as the most efficiently stacked ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap Boldenone Cypionate Muscle Growth Hormone Raw Steroid Powder 106505-90-2 product

Brand Name:Bio Friend(BOF)

Model Number:106505-90-2

Place of Origin:China Wuhan

...Boldenone Cypionate Muscle Growth Hormone Raw Steroid Powder 106505-90-2 COA: Product name Boldenone Cypionate Water Content 0.5%max 0.28% Specific ...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Buy cheap Muscle Growth Hormones Pure Testosterone Steroid for Testosterone Cypionate Cycle CAS 58-20-8 product

Model Number:58-20-8

... dosage and good results for testosterone cypionate cycle Testosterone is a hormone produced by all human beings and is the primary male sex hormone. Through our discussion, well take a look at Testosterone Cypionate...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Buy cheap Raw Muscle Growth Hormone Powder Turinabol Clostebol Acetate CAS855-19-6 product

Brand Name:Yuancheng

Model Number:855-19-6

Place of Origin:Wuhan,Hubei

...Raw Muscle Growth Hormone Powder Turinabol Clostebol Acetate CAS855-19-6 Alias: Megagrisevit; Clostebol acetate CAS No: 855-19-6 Einecs ...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Buy cheap Lyophilized Peptides Powder Hexarelin ( Hexarelin Acetate ) for Muscle Growth Hormones product

Brand Name:wumeitech

Model Number:Hexarelin Acetate

Place of Origin:China

...Lyophilized Peptides Powder Hexarelin (Hexarelin Acetate) for Muscle Growth Alias: HEX, Hexarelin Acetate, Examorelin Hexarelin CAS: 140703-51-1 Hexarelin Sequence: His-D-2-methyl-Trp-Ala-...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap IGF DES 1mg / vial HGH Anabolic Steroids Muscle Growth Hormone Peptides Protection product

Brand Name:GB

Model Number:1mg/vial 10vials/box

Place of Origin:China

...IGF-1DES 1mg / vial Muscle Growth Hormone Peptides Protection 1. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 2. Molar Mass: 7,372 Da 3. Synonyms: IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3) 4. Compound: ...

Hubei God bull Pharmaceutical Co.,Ltd
Verified Supplier

Hubei

Buy cheap Testosterone Decanoate Muscle Growth Hormone Nutrition Supplements Neotest 250 product

Brand Name:email: lisa@pharmade.com

Model Number:15262-86-9

Place of Origin:China

...Testosterone Decanoate Muscle Growth Hormone Nutrition Supplements Neotest 250 Description: Testosterone Decanoate: Anabolic Hormones; Anabolin; Anabolic Steroids; Steroid Powder; Hormone Powders; Bodybuilding; Raw Powder; Muscle Building; Raw Testosterone...

Shenzhen Shijingu Technology Co., Ltd.
Verified Supplier

Guangdong

Buy cheap Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding product

Brand Name:KA-XING

Model Number:315-37-7

Place of Origin:Guangdong ,China

CJC-1295 without DAC from Peptides 1.Quick Detail: Product Name: CJC-1295 English name: CJC-1295 (without DAC) CAS number: 863288-34-0 Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Tyr- Gln-Asp-Ile-Leu-Ser-Arg-NH2 Molecular formula: C152H252N44O42 ...

Zhuhai Jiacheng Bio-Tech Co., Ltd.
Verified Supplier

Macau

Go to Page
Inquiry Cart 0